PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013635639.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 370aa    MW: 40773.5 Da    PI: 4.9294
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013635639.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.81.6e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rgrWT+eEd +l  +++  G g+W++ ++  g++R++k+c++rw +yl
   XP_013635639.1 14 RGRWTAEEDHILSSYIQSNGEGSWRSLPKNAGLKRCGKSCRLRWINYL 61
                     8*********************************************97 PP

2Myb_DNA-binding53.26.7e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T eE+el v+++  lG++ W++Ia +++ gRt++++k++w+++l
   XP_013635639.1  67 RGNITREEEELVVNLHSTLGNR-WSLIAGHLP-GRTDNEIKNYWNSHL 112
                      7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-21564IPR009057Homeodomain-like
PROSITE profilePS5129416.458961IPR017930Myb domain
SuperFamilySSF466891.72E-2711108IPR009057Homeodomain-like
SMARTSM007174.4E-101363IPR001005SANT/Myb domain
PfamPF002496.6E-141461IPR001005SANT/Myb domain
CDDcd001671.18E-71661No hitNo description
PROSITE profilePS5129425.71962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.0E-2565116IPR009057Homeodomain-like
SMARTSM007173.6E-1666114IPR001005SANT/Myb domain
PfamPF002491.8E-1467112IPR001005SANT/Myb domain
CDDcd001671.38E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MGRAPCCEKV GIKRGRWTAE EDHILSSYIQ SNGEGSWRSL PKNAGLKRCG KSCRLRWINY  60
LRSDLKRGNI TREEEELVVN LHSTLGNRWS LIAGHLPGRT DNEIKNYWNS HLRRKLHNFI  120
IRKPSISHDA PAVIMNVPPA SPRPPSKRRP GRTSRSAMKP KTRKTKRTSA PPEPEADVAV  180
KEVAGEEAIM MELNGAEAEL GPCDYYGAYH EGGDCCNNNN NLMGTNGDNL VLSFDDNIMD  240
LLLDEADACN VLTSCGGDAE LSHLGDSEVA RGLSETSINQ GNLDCLQPCP SVQSLINYEL  300
PATDASMDEC IDWHEGNRNS LCGEKEGSDS IVSWLLDGDD DATVGKTNCE NFGEPLDHDE  360
ENALVAWLVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-231211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00627PBMTransfer from PK06182.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013635639.10.0PREDICTED: transcription factor MYB12-like
SwissprotO222641e-172MYB12_ARATH; Transcription factor MYB12
TrEMBLA0A0D3C6Q40.0A0A0D3C6Q4_BRAOL; Uncharacterized protein
TrEMBLA0A0D2ZRU90.0A0A0D2ZRU9_BRAOL; Uncharacterized protein
STRINGBra000453.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.11e-155myb domain protein 12